PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936654.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 487aa    MW: 54297.2 Da    PI: 6.1254
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936654.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.92.8e-5191351127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGf FhPtd el+++yLkkk+ g+k+++ e+i+evdiyk+ePwdLp+  ++ +++++w+fF++rd+ky++g+r+nrat++gyWk+tgkd++v+
  XP_010936654.1   9 LPPGFGFHPTDVELISHYLKKKILGQKIDF-EIIPEVDIYKHEPWDLPAkcHIPTRDSKWHFFASRDRKYPNGSRSNRATEAGYWKSTGKDRNVK 102
                     79****************************.99***************5346667899************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyr 127
                       +++++g+kktLvf+kgr p g++tdW+mhey 
  XP_010936654.1 103 L-HNRVIGTKKTLVFHKGRPPCGKRTDWIMHEYY 135
                     *.999****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-594159IPR003441NAC domain
PROSITE profilePS5100555.7149159IPR003441NAC domain
PfamPF023654.9E-2510135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
METLSAFSLP PGFGFHPTDV ELISHYLKKK ILGQKIDFEI IPEVDIYKHE PWDLPAKCHI  60
PTRDSKWHFF ASRDRKYPNG SRSNRATEAG YWKSTGKDRN VKLHNRVIGT KKTLVFHKGR  120
PPCGKRTDWI MHEYYIAENE CKTAPGMKDI FVLCRVTKRN GLSLEGEMTQ SEMVSDVQEQ  180
PKDMVGSVPC EESSSPSNVE DIEAWLLELY DPDFNGIHSI HARNNEAEAD PASILSKQEP  240
VESCLQPPGA DDQDYLLPDD ISSILQSGSD NFNLDMFGEP NFESIDGGSV LLYDAAMTSN  300
ELSPAVSNFV YEGVKREDEN IDTGIQIRQR HAKPPTAISN HSIKLQIYKM ESRNPGPLNQ  360
TIKLVKEDRH LDMNDGDNKH LPGAESSTIS DSEGNQSDLS CHTASKTLQK RSTDPVRPQK  420
SPGGLVDKVC STRGVIRGLN RLLCGCSSAG LNCLFFSACM VGTAALILYF LLRDARRFLA  480
SYNSLGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-46515611165Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936654.10.0PREDICTED: NAC domain-containing protein 74-like isoform X2
TrEMBLM0T1371e-147M0T137_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P23620_0011e-147(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.11e-69NAC domain containing protein 86